Alternative Name(s):

Associate of Myc 1 ;AMY-1

Species: (Organism)

Homo sapiens (Human)

Gene Names:

MYCBP

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

AHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE

Expression Region:

2-103aa

Subcellular Location:

Cytoplasm, Nucleus, Mitochondrion

Tissue Specificity:

Highly expressed in heart, placenta, pancreas, skeletal muscle and kidney. Also present at low levels in lung.

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

27.8 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Epigenetics and Nuclear Signaling

Function:

May control the transcriptional activity of MYC. Stimulates the activation of E box-dependent transcription by MYC.

Involvement in disease:

Relevance:

May control the transcriptional activity of MYC. Stimulates the activation of E box-dependent transcription by MYC.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

AMY1 family

Reference:

AMY-1, a novel C-MYC binding protein that stimulates transcription activity of C-MYC.Taira T., Maeda J., Ohishi T., Kitaura H., Yoshida S., Kato H., Ikeda M., Tamai K., Iguchi-Ariga S.M.M., Ariga H.Genes Cells 3:549-565(1998)