Alternative Name(s):

Bcl 2 modifying factor; Bcl-2-modifying factor; Bcl2 modifying factor; Bmf; BMF_HUMAN; FLJ00065

Species: (Organism)

Homo sapiens (Human)

Gene Names:

BMF

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSPGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR

Expression Region:

1-184aa

Subcellular Location:

Tissue Specificity:

Isoform 1 is mainly expressed in B-lymphoid cells. Isoform 2 and isoform 3 are mainly expressed in B-CLL and normal B-cells.

Protein Length:

Full Length of BC069505

Pathway:

Mol. Weight:

47.5 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cell Biology

Function:

May play a role in apoptosis. Isoform 1 seems to be the main initiator.

Involvement in disease:

Relevance:

May play a role in apoptosis. Isoform 1 seems to be the main initiator.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Bcl-2 family

Reference:

"Bmf: a proapoptotic BH3-only protein regulated by interaction with the myosin V actin motor complex, activated by anoikis." Puthalakath H., Villunger A., O'Reilly L.A., Beaumont J.G., Coultas L., Cheney R.E., Huang D.C.S., Strasser A. Science 293:1829-1832(2001)