Alternative Name(s):

2310008D05Rik; Endothelial cell adhesion molecule; Endothelial cell selective adhesion molecule; Endothelial cell-selective adhesion molecule; Esam; ESAM_HUMAN; HUEL (C4orf1) interacting protein ; LP4791 protein ; W117m

Species: (Organism)

Homo sapiens (Human)

Gene Names:

ESAM

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAA

Expression Region:

30-248aa

Subcellular Location:

Cell junction, adherens junction, Cell junction, tight junction, Cell membrane, Single-pass type I membrane protein

Tissue Specificity:

Highly expressed in endothelial cells.

Protein Length:

Extracellular Domain

Pathway:

Leukocytetransendothelialmigration

Mol. Weight:

39.8 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cell Adhesion

Function:

Can mediate aggregation most likely through a homophilic molecular interaction.

Involvement in disease:

Relevance:

Can mediate aggregation most likely through a homophilic molecular interaction.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

Cloning of an immunoglobulin family adhesion molecule selectively expressed by endothelial cells.Hirata K., Ishida T., Penta K., Rezaee M., Yang E., Wohlgemuth J., Quertermous T.J. Biol. Chem. 276:16223-16231(2001)