Recombinant Human Abhydrolase domain-containing protein 14B(ABHD14B) CSB-EP842687HU
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
ABHD14B; ABHEB_HUMAN; Abhydrolase domain containing 14B; Abhydrolase domain containing protein 14B; Abhydrolase domain-containing protein 14B; CCG1 interacting factor B; CCG1-interacting factor B; Cell cycle gene 1 interacting factor B; CIB; MGC15429; OTTHUMP00000212469
Species: (Organism)
Homo sapiens (Human)
Gene Names:
ABHD14B
Tag info:
N-terminal 6xHis-SUMO-tagged
Target Protein AA Sequence:
AASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ
Expression Region:
2-210aa
Subcellular Location:
Cytoplasm, Nucleus
Tissue Specificity:
Ubiquitous. Detected in spleen, thymus, prostate, testis, ovary, small intestine, colon, peripheral blood leukocyte, heart, placenta, lung, liver, skeletal muscle, pancreas and kidney.
Protein Length:
Full Length of Mature Protein
Pathway:
Mol. Weight:
38.2 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Cell Biology
Function:
Has hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription.
Involvement in disease:
Relevance:
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
AB hydrolase superfamily, ABHD14 family
Reference:
"Initial characterization of the human central proteome."Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
