Alternative Name(s):

C-type lectin superfamily member -type lectin-like receptor 6 ;CLEC-6

Species: (Organism)

Homo sapiens (Human)

Gene Names:

CLEC4D

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

CLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN

Expression Region:

39-215aa

Subcellular Location:

Membrane, Single-pass type II membrane protein

Tissue Specificity:

Expressed weakly in peripheral blood leukocytes, bone marrow and spleen. Expression is confined mostly in monocytes and macrophage and seems to be up-regulated by IL-6, IL-10, TNF-alpha and IFN-gamma.

Protein Length:

Extracellular Domain

Pathway:

Mol. Weight:

36.7 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Immunology

Function:

Functions as an endocytic receptor. May be involved in antigen uptake at the site of infection, either for clearance of the antigen, or for processing and further presentation to T cells.

Involvement in disease:

Relevance:

Functions as an endocytic receptor. May be involved in antigen uptake at the site of infection, either for clearance of the antigen, or for processing and further presentation to T cells.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

The human C-type lectin CLECSF8 is a novel monocyte/macrophage endocytic receptor.Arce I., Martinez-Munoz L., Roda-Navarro P., Fernandez-Ruiz E.Eur. J. Immunol. 34:210-220(2004)