Alternative Name(s):

RING finger protein 125 T-cell RING activation protein 1

Species: (Organism)

Homo sapiens (Human)

Gene Names:

RNF125

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

GSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCVCPFCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNTT

Expression Region:

1-232aa

Subcellular Location:

Golgi apparatus membrane, Lipid-anchor

Tissue Specificity:

Predominantly expressed in lymphoid tissues, including bone marrow, spleen and thymus. Also weakly expressed in other tissues. Predominant in the CD4(+) and CD8(+) T-cells, suggesting that it is preferentially confined to T-cells.

Protein Length:

Full Length

Pathway:

Mol. Weight:

53.3 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cell Biology

Function:

E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins, such as DDX58/RIG-I, MAVS/IPS1, IFIH1/MDA5, JAK1 and p53/TP53

Involvement in disease:

Tenorio syndrome (TNORS)

Relevance:

E3 ubiquitin-protein ligase that acts as a positive regulator of T-cell activation. E3 ligase proteins mediate ubiquitination and subsequent proteasomal degradation of target proteins.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

"Systematic identification of regulatory proteins critical for T-cell activation." Chu P., Pardo J., Zhao H., Li C.C., Pali E., Shen M.M., Qu K., Yu S.X., Huang B.C.B., Yu P., Masuda E.S., Molineaux S.M., Kolbinger F., Aversa G., de Vries J., Payan D.G., Liao X.C. J. Biol. 2:21.1-21.16(2003)