Recombinant Human Sentrin-specific protease 8(SENP8) CSB-EP822251HU
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
Deneddylase-1NEDD8-specific protease 1;Protease, cysteine 2Sentrin/SUMO-specific protease SENP8
Species: (Organism)
Homo sapiens (Human)
Gene Names:
SENP8
Tag info:
N-terminal 6xHis-SUMO-tagged
Target Protein AA Sequence:
MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK
Expression Region:
1-212aa
Subcellular Location:
Tissue Specificity:
Broadly expressed, with highest levels in kidney and pancreas.
Protein Length:
Full Length
Pathway:
Mol. Weight:
40.1 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Epigenetics and Nuclear Signaling
Function:
Protease that catalyzes two essential functions in the NEDD8 pathway
Involvement in disease:
Relevance:
Protease that catalyzes two essential functions in the NEDD8 pathway: processing of full-length NEDD8 to its mature form and deconjugation of NEDD8 from targeted proteins such as cullins or p53.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Peptidase C48 family
Reference:
Structure of a complex between Nedd8 and the Ulp/Senp protease family member Den1.Reverter D., Wu K., Erdene T.G., Pan Z.-Q., Wilkinson K.D., Lima C.D.J. Mol. Biol. 345:141-151(2005)
