Alternative Name(s):

Alpha-2,8-sialyltransferase 8DPolysialyltransferase-1Sialyltransferase 8D ;SIAT8-DSialyltransferase St8Sia IV ;ST8SiaIV

Species: (Organism)

Homo sapiens (Human)

Gene Names:

ST8SIA4

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

KTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR

Expression Region:

21-168aa

Subcellular Location:

Golgi apparatus membrane, Single-pass type II membrane protein

Tissue Specificity:

Highly expressed in fetal brain, lung and kidney and in adult heart, spleen and thymus. Present to a lesser extent in adult brain, placenta, lung, large and small intestine and peripheral blood leukocytes.

Protein Length:

Full Length of Isoform 2

Pathway:

Mol. Weight:

32.8 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Tags & Cell Markers

Function:

Catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid (PSA), which is present on the embryonic neural cell adhesion molecule (N-CAM), necessary for plasticity of neural cells.

Involvement in disease:

Relevance:

Catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid (PSA), which is present on the bryonic neural cell adhesion molecule (N-CAM), necessary for plasticity of neural cells.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Glycosyltransferase 29 family

Reference:

Expression cloning of a human polysialyltransferase that forms the polysialylated neural cell adhesion molecule present in embryonic brain.Nakayama J., Fukuda M.N., Fredette B., Ranscht B., Fukuda M.Proc. Natl. Acad. Sci. U.S.A. 92:7031-7035(1995)