Recombinant Human CMRF35-like molecule 1(CD300LF),partial CSB-EP819470HU
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
CD300 antigen-like family member FImmune receptor expressed on myeloid cells 1 ;IREM-1Immunoglobulin superfamily member 13 ;IgSF13NK inhibitory receptor; CD300f
Species: (Organism)
Homo sapiens (Human)
Gene Names:
CD300LF
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS
Expression Region:
20-156aa
Subcellular Location:
Cell membrane, Single-pass type I membrane protein
Tissue Specificity:
Highly expressed in spleen, peripheral blood leukocyte and monocyte, and lung. Weakly expressed in thymus, heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, testis, ovary, small intestine or colon. Expressed selectively in monocytes and monocyte-related cells.
Protein Length:
Extracellular Domain
Pathway:
Mol. Weight:
19.5 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Immunology
Function:
Acts as an inhibitory receptor for myeloid cells and mast cells
Involvement in disease:
Relevance:
Acts as an inhibitory receptor for myeloid cells and mast cells. Inhibits osteoclast formation.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
CD300 family
Reference:
IgSF13, a novel human inhibitory receptor of the immunoglobulin superfamily, is preferentially expressed in dendritic cells and monocytes.Sui L., Li N., Liu Q., Zhang W., Wan T., Wang B., Luo K., Sun H., Cao X.Biochem. Biophys. Res. Commun. 319:920-928(2004)
