Alternative Name(s):

Polyprotein nsP1234

Species: (Organism)

Chikungunya virus (strain S27-African prototype) (CHIKV)

Gene Names:

nsp4

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

DTVLETDIASFDKSQDDSLALTALMLLEDLGVDHSLLDLIEAAFGEISSCHLPTGTRFKFGAMMKSGMFLTLFVNTLLNITIASRVLEDRLTKSACAAFIGDDNIIHGVVSDELMAARCATWMNMEVKIIDAVVSQKAPYFCGGFILHDIVTGTACRVADPLKRLFKLGKPLAAGDEQDEDRRRALADEVVRWQRTGLIDELEKAVYSRYEVQGISVVVMSMATFASSRSNFEKLRGPVVTLYGGPK

Expression Region:

2228-2474aa

Subcellular Location:

Non-structural polyprotein: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Note=Located on the cytoplasmic surface of modified endosomes and lysosomes, also called cytopathic vacuoles type I (CPVI), These vacuoles contain numerous small circular invaginations (spherules) which may be the sites of RNA synthesis, SUBCELLULAR LOCATION: P123: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, SUBCELLULAR LOCATION: mRNA-capping enzyme nsP1: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Host cell membrane, Peripheral membrane protein, Cytoplasmic side, Note=In the late phase of infection, the polyprotein is quickly cleaved before localization to cellular membranes, Then a fraction of nsP1 localizes to the inner surface of the plasma membrane and its filopodial extensions (By similarity), SUBCELLULAR LOCATION: Protease nsP2: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Host nucleus, Note=In the late phase of infection, the polyprotein is quickly cleaved before localization to cellular membranes, Then approximately half of nsP2 is found in the nucleus (By similarity), SUBCELLULAR LOCATION: Non-structural protein 3: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Host cytoplasm

Tissue Specificity:

Protein Length:

Partial

Pathway:

Mol. Weight:

31.1 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

P123 is short-lived polyproteins, accumulating during early stage of infection. It localizes the viral replication complex to the cytoplasmic surface of modified endosomes and lysosomes. By interacting with nsP4, it starts viral genome replication into antigenome. After these early events, P123 is cleaved sequentially into nsP1, nsP2 and nsP3. This sequence of delayed processing would allow correct assembly and membrane association of the RNA polymerase complex (By similarity).

Involvement in disease:

Relevance:

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

"Complete nucleotide sequence of chikungunya virus and evidence for an internal polyadenylation site."Khan A.H., Morita K., Parquet Md Mdel C., Hasebe F., Mathenge E.G., Igarashi A.J. Gen. Virol. 83:3075-3084(2002)