Recombinant Mouse Interferon epsilon(Ifne) CSB-EP800374MO
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
Interferon epsilon-1Interferon tau-1
Species: (Organism)
Mus musculus (Mouse)
Gene Names:
Ifne
Tag info:
N-terminal 6xHis-SUMO-tagged
Target Protein AA Sequence:
LEPKRIPFQLWMNRESLQLLKPLPSSSVQQCLAHRKNFLLPQQPVSPHQYQEGQVLAVVHEILQQIFTLLQTHGTMGIWEENHIEKVLAALHRQLEYVESLGGLNAAQKSGGSSAQNLRLQIKAYFRRIHDYLENQRYSSCAWIIVQTEIHRCMFFVFRFTTWLSRQDPDP
Expression Region:
22-192aa
Subcellular Location:
Secreted
Tissue Specificity:
Expressed at very high levels in uterus and, at much lower levels, in ovary and cervix. Very low levels, if any, in other organs. In the endometrium, expressed in the luminal and glandular epithelial cells (at protein level).
Protein Length:
Full Length of Mature Protein
Pathway:
Mol. Weight:
36 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Others
Function:
Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the female reproductive tract. Directly mediates protection against viral, including HSV-2, and bacterial, including Chlamydia muridarum, genital infections.
Involvement in disease:
Relevance:
Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the fale reproductive tract. Directly mediates protection against viral, including HSV-2, and bacterial, including Chlamydia muridarum, genital infections.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Alpha/beta interferon family
Reference:
Interferon-epsilon protects the female reproductive tract from viral and bacterial infection.Fung K.Y., Mangan N.E., Cumming H., Horvat J.C., Mayall J.R., Stifter S.A., De Weerd N., Roisman L.C., Rossjohn J., Robertson S.A., Schjenken J.E., Parker B., Gargett C.E., Nguyen H.P., Carr D.J., Hansbro P.M., Hertzog P.J.Science 339:1088-1092(2013)
