Recombinant Pan troglodytes Lymphotoxin-beta(LTB),partial CSB-EP771253EQV
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
Tumor necrosis factor C ;TNF-CTumor necrosis factor ligand superfamily member 3
Species: (Organism)
Pan troglodytes (Chimpanzee)
Gene Names:
LTB
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
QDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRTPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG
Expression Region:
49-244aa
Subcellular Location:
Membrane, Single-pass type II membrane protein
Tissue Specificity:
Protein Length:
Extracellular Domain
Pathway:
Mol. Weight:
24.8 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Others
Function:
Cytokine that binds to LTBR/TNFRSF3. May play a specific role in immune response regulation. Provides the membrane anchor for the attachment of the heterotrimeric complex to the cell surface (By similarity).
Involvement in disease:
Relevance:
Cytokine that binds to LTBR/TNFRSF3. May play a specific role in immune response regulation. Provides the mbrane anchor for the attachment of the heterotrimeric complex to the cell surface .
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Tumor necrosis factor family
Reference:
Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity.Shiina T., Ota M., Shimizu S., Katsuyama Y., Hashimoto N., Takasu M., Anzai T., Kulski J.K., Kikkawa E., Naruse T., Kimura N., Yanagiya K., Watanabe A., Hosomichi K., Kohara S., Iwamoto C., Umehara Y., Meyer A. , Wanner V., Sano K., Macquin C., Ikeo K., Tokunaga K., Gojobori T., Inoko H., Bahram S.Genetics 173:1555-1570(2006)
