Recombinant Mouse Serine/threonine-protein kinase VRK1(Vrk1) CSB-EP768902MO
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
Serine/threonine-protein kinase 51PK Vaccinia-related kinase 1
Species: (Organism)
Mus musculus (Mouse)
Gene Names:
Vrk1
Tag info:
N-terminal 6xHis-tagged and C-terminal Myc-tagged
Target Protein AA Sequence:
MPRVKAAQAGRPGPAKRRLAEQFAAGEVLTDMSRKEWKLGLPIGQGGFGCIYLADTNSSKPVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTHKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLSHKNPDQVYLVDYGLAYRYCPDGVHKEYKEDPKRCHDGTLEFTSIDAHKGVAPSRRGDLEILGYCMIQWLSGCLPWEDNLKDPNYVRDSKIRYRDNVAALMEKCFPEKNKPGEIAKYMESVKLLEYTEKPLYQNLRDILLQGLKAIGSKDDGKLDFSAVENGSVKTRPASKKRKKEAEESAVCAVEDMECSDTQVQEAAQTRSVESQGAIHGSMSQPAAGCSSSDSSRRQQHLGLEQDMLRLDRRGSRTRKKAQK
Expression Region:
1-440aa
Subcellular Location:
Cytoplasm, Nucleus, Cytoplasm, cytoskeleton, spindle
Tissue Specificity:
Highly expressed in testis. Expressed in liver, kidney and muscle. Weakly expressed in thymus, bone marrow and spleen.
Protein Length:
Full Length
Pathway:
Mol. Weight:
55.2 kDa
Purity:
Greater than 85% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Cell Biology
Function:
Serine/threonine kinase involved in Golgi disassembly during the cell cycle
Involvement in disease:
Relevance:
Serine/threonine kinase involved in Golgi disassembly during the cell cycle: following phosphorylation by PLK3 during mitosis, required to induce Golgi fragmentation. Acts by mediating phosphorylation of downstream target protein. Phosphorylates 'Thr-18' of p53/TP53 and may thereby prevent the interaction between p53/TP53 and MDM2. Phosphorylates casein and histone H3. Phosphorylates BANF1: disrupts its ability to bind DNA, reduces its binding to LEM domain-containing proteins and causes its relocalization from the nucleus to the cytoplasm. Phosphorylates ATF2 which activates its transcriptional activity
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Protein kinase superfamily, CK1 Ser/Thr protein kinase family, VRK subfamily
Reference:
"Characterization of three paralogous members of the Mammalian vaccinia related kinase family." Nichols R.J., Traktman P. J. Biol. Chem. 279:7934-7946(2004)
