Alternative Name(s):

Chondroitin sulfate proteoglycan core protein 2 (Chondroitin sulfate proteoglycan 2) (Large fibroblast proteoglycan) (PG-M) (Cspg2)

Species: (Organism)

Mus musculus (Mouse)

Gene Names:

Vcan

Tag info:

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein AA Sequence:

AKMETSPPVKGSLSGKVVLPCHFSTLPTLPPNYNTSEFLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAAVYRCDVMYGIEDTQDTMSLA

Expression Region:

24-146aa

Subcellular Location:

Secreted, extracellular space, extracellular matrix

Tissue Specificity:

Isoform V2 is found only in brain.

Protein Length:

Partial

Pathway:

Mol. Weight:

20.9 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.

Involvement in disease:

Relevance:

May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Aggrecan/versican proteoglycan family

Reference:

"Selective activation of the versican promoter by epithelial- mesenchymal interactions during hair follicle development." Kishimoto J., Ehama R., Wu L., Jiang S., Jiang N., Burgeson R.E. Proc. Natl. Acad. Sci. U.S.A. 96:7336-7341(1999)