Alternative Name(s):

Cystatin-like molecule

Species: (Organism)

Homo sapiens (Human)

Gene Names:

CST9

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

WCSEEEMGGNNKIVQDPMFLATVEFALNTFNVQSKEEHAYRLLRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK

Expression Region:

29-159aa

Subcellular Location:

Secreted

Tissue Specificity:

Expressed in heart, placenta, lung, liver, skeletal muscle and pancreas (PubMed:12535658). Not expressed in brain (PubMed:12535658). Expressed in epididymis, kidney, testis, spinal cord, and thymus with a strong expression in epididymis and kidney and a weak expression in the spinal cord and thymus (PubMed:20565543).

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

18.9 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cell Biology

Function:

May be involved in testis development (By similarity). May play a role in hematopoietic differentiation or inflammation

Involvement in disease:

Relevance:

May be involved in testis development (By similarity). May play a role in hematopoietic differentiation or inflammation (PubMed:12535658). Has immunomodulatory and antimicrobial functions against Francisella tularensis, a Gram-negative bacteria (PubMed:23922243).

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Cystatin family

Reference:

"Molecular cloning and characterization of a novel cystatin-like molecule, CLM, from human bone marrow stromal cells."Sun H., Li N., Wang X., Liu S., Chen T., Zhang L., Wan T., Cao X.Biochem. Biophys. Res. Commun. 301:176-182(2003)