Recombinant Human PDZ domain-containing protein 11(PDZD11) CSB-EP707840HU
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
ATPase-interacting PDZ protein;Plasma membrane calcium ATPase-interacting single-PDZ protein ;PMCA-interacting single-PDZ protein
Species: (Organism)
Homo sapiens (Human)
Gene Names:
PDZD11
Tag info:
N-terminal 6xHis-SUMO-tagged
Target Protein AA Sequence:
MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH
Expression Region:
1-140aa
Subcellular Location:
Isoform 2: Secreted, SUBCELLULAR LOCATION: Isoform 1: Cytoplasm
Tissue Specificity:
Widely expressed (at protein level).
Protein Length:
Full Length
Pathway:
Mol. Weight:
32.1 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Cell Biology
Function:
Involvement in disease:
Relevance:
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Reference:
Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. , Gu J., Chen S.-J., Chen Z.Genome Res. 10:1546-1560(2000)
