Alternative Name(s):

Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein Imprinted in placenta and liver protein Tumor-suppressing STF cDNA 3 protein Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein p17-Beckwith-Wiedemann region 1 C

Species: (Organism)

Homo sapiens (Human)

Gene Names:

PHLDA2

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP

Expression Region:

1-152aa

Subcellular Location:

Cytoplasm, Membrane, Peripheral membrane protein

Tissue Specificity:

Expressed in placenta and adult prostate gland. In placenta, it is present in all cells of the villous cytotrophoblast. The protein is absent in cells from hydatidiform moles. Hydatidiform mole is a gestation characterized by abnormal development of both fetus and trophoblast. The majority of hydatidiform moles are associated with an excess of paternal to maternal genomes and are likely to result from the abnormal expression of imprinted genes (at protein level). Expressed at low levels in adult liver and lung, and fetal liver. Expressed in adult brain and neuroblastoma, medullablastoma and glioblastoma cell lines.

Protein Length:

Full Length

Pathway:

Mol. Weight:

44.1 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cell Biology

Function:

Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids (By similarity).

Involvement in disease:

Relevance:

Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

PHLDA2 family

Reference:

"A 2.5-Mb transcript map of a tumor-suppressing subchromosomal transferable fragment from 11p15.5, and isolation and sequence analysis of three novel genes." Hu R.-J., Lee M.P., Connors T.D., Johnson L.A., Burn T.C., Su K., Landes G.M., Feinberg A.P. Genomics 46:9-17(1997)