Recombinant Lake Victoria marburgvirus Matrix protein VP40(VP40) CSB-EP638155LAAT
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
Membrane-associated protein VP40
Species: (Organism)
Lake Victoria marburgvirus (strain Angola/2005) (MARV)
Gene Names:
VP40
Tag info:
N-terminal 6xHis-SUMO-tagged
Target Protein AA Sequence:
MASSSNYNTYMQYLNPPPYADHGANQLIPADQLSNQQGITPNYVGDLNLDDQFKGNVCHAFTLEAIIDISAYNERTVKGVPAWLPLGIMSNFEYPLAHTVAALLTGSYTITQFTHNGQKFVRVNRLGTGIPAHPLRMLREGNQAFIQNMVIPRNFSTNQFTYNLTNLVLSVQKLPDDAWRPSKDKLIGNTMHPAVSVHPNLPPIVLPTVKKQAYRQHKNPNNGPLLAISGILHQLRVEKVPEKTSLFRISLPADMFSVKEGMMKKRGENSPVVYFQAPENFPLNGFNNRQVVLAYANPTLSAV
Expression Region:
1-303aa
Subcellular Location:
Virion membrane, Peripheral membrane protein, Host late endosome membrane, Peripheral membrane protein, Host cell membrane, Peripheral membrane protein, Cytoplasmic side, Host endomembrane system, Peripheral membrane protein
Tissue Specificity:
Protein Length:
Full Length
Pathway:
Mol. Weight:
49.8 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Others
Function:
Promotes virus assembly and budding by interacting with host proteins of the multivesicular body pathway. May facilitate virus budding by interacting with the nucleocapsid and the plasma membrane. Specific interactions with membrane-associated GP and VP24 during the budding process may also occur. May play a role in genome replication (By similarity).
Involvement in disease:
Relevance:
Promotes virus assbly and budding by interacting with host proteins of the multivesicular body pathway. May facilitate virus budding by interacting with the nucleocapsid and the plasma mbrane. Specific interactions with mbrane-associated GP and VP24 during the budding process may also occur. May play a role in genome replication .
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Filoviridae matrix protein VP40 family
Reference:
Marburgvirus genomics and association with a large hemorrhagic fever outbreak in Angola.Towner J.S., Khristova M.L., Sealy T.K., Vincent M.J., Erickson B.R., Bawiec D.A., Hartman A.L., Comer J.A., Zaki S.R., Stroeher U., Gomes da Silva F., del Castillo F., Rollin P.E., Ksiazek T.G., Nichol S.T.J. Virol. 80:6497-6516(2006)
