Alternative Name(s):

Activator-recruited cofactor 205KDA component Short name: ARC205 Mediator complex subunit 1 Peroxisome proliferator-activated receptor-binding protein Short name: PBP Short name: PPAR-binding protein Thyroid hormone receptor-associated protein complex 220KDA component Short name: Trap220 Thyroid receptor-interacting protein 2 Short name: TR-interacting protein 2 Short name: TRIP-2 Vitamin D receptor-interacting protein complex component DRIP205 p53 regulatory protein RB18A

Species: (Organism)

Homo sapiens (Human)

Gene Names:

MED1

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

FGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPF

Expression Region:

878-1031aa

Subcellular Location:

Nucleus

Tissue Specificity:

Ubiquitously expressed.

Protein Length:

Partial

Pathway:

Mol. Weight:

32.2 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Epigenetics and Nuclear Signaling

Function:

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors

Involvement in disease:

Relevance:

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (PubMed:10406464, PubMed:11867769, PubMed:12037571, PubMed:12218053, PubMed:12556447, PubMed:14636573, PubMed:15340084, PubMed:15471764, PubMed:15989967, PubMed:16574658, PubMed:9653119). Acts as a coactivator for GATA1-mediated transcriptional activation during erythroid differentiation of K562 erythroleukemia cells (PubMed:24245781).

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Mediator complex subunit 1 family

Reference:

"The TRAP220 component of a thyroid hormone receptor-associated protein (TRAP) coactivator complex interacts directly with nuclear receptors in a ligand-dependent fashion."Yuan C.-X., Ito M., Fondell J.D., Fu Z.-Y., Roeder R.G.Proc. Natl. Acad. Sci. U.S.A. 95:7939-7944(1998).