Alternative Name(s):

Retinoic acid-induced gene E protein Short name: RIG-E Stem cell antigen 2 Short name: SCA-2 Thymic shared antigen 1 Short name: TSA-1

Species: (Organism)

Homo sapiens (Human)

Gene Names:

LY6E

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS

Expression Region:

21-101aa

Subcellular Location:

Cell membrane, Lipid-anchor, GPI-anchor

Tissue Specificity:

Widely expressed, predominantly in liver, kidney, ovary, spleen and peripheral blood Leukocytes.

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

24.5 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cell Biology

Function:

Involved in T-cell development. Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3

Involvement in disease:

Relevance:

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

"Complete sequencing and characterization of 21,243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004)