Alternative Name(s):

Short name:MAPUniRule annotation Short name:MetAPUniRule annotation Alternative name(s): Peptidase M

Species: (Organism)

Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Gene Names:

map

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

MVYLKSAREVEQIRQACKIFQEAKAYFTIERLLGKSLTAIDQALKQFIESKGATCAFHKYQNFPGFNCLSLNETVIHGIADNRVFGVKDKLTLDIGINLNGYICDAAFTVLGPKAPEPMQTLLEVTEACFTAVVEPQLRPNNPTGNVSHAIQTYFESKGYYLLKQFGGHGCGIKVHEEPLILNYGKPDTGTKLEPGMVLCIEPMVMTDSDAMVMHNNSWNVLTPKSRYNCHVEQMYVITTSGFECLTN

Expression Region:

1-248aa

Subcellular Location:

Tissue Specificity:

Protein Length:

Full Length

Pathway:

Mol. Weight:

43.7 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cell Biology

Function:

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Involvement in disease:

Relevance:

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Peptidase M24A family, Methionine aminopeptidase type 1 subfamily

Reference:

"Complete sequence analysis of the genome of the bacterium Mycoplasma pneumoniae."Himmelreich R., Hilbert H., Plagens H., Pirkl E., Li B.-C., Herrmann R.Nucleic Acids Res. 24:4420-4449(1996)