Alternative Name(s):

Beta-galactoside alpha-2,3-sialyltransferase 3 ;Alpha 2,3-ST 3Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferaseN-acetyllactosaminide alpha-2,3-sialyltransferase;ST3Gal III ;ST3GalIIIST3NSialyltransferase 6

Species: (Organism)

Homo sapiens (Human)

Gene Names:

ST3GAL3

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI

Expression Region:

29-375aa

Subcellular Location:

Golgi apparatus, Golgi stack membrane, Single-pass type II membrane protein, Secreted

Tissue Specificity:

Highly expressed in adult skeletal muscle and in all fetal tissues examined and to a much lesser extent in placenta, lung and liver.

Protein Length:

Partial

Pathway:

Mol. Weight:

54.9 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- and NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc.

Involvement in disease:

Mental retardation, autosomal recessive 12 (MRT12); Epileptic encephalopathy, early infantile, 15 (EIEE15)

Relevance:

Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc .

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Glycosyltransferase 29 family

Reference:

West syndrome caused by ST3Gal-III deficiency.Edvardson S., Baumann A.M., Muehlenhoff M., Stephan O., Kuss A.W., Shaag A., He L., Zenvirt S., Tanzi R., Gerardy-Schahn R., Elpeleg O.Epilepsia 54:E24-E27(2013)