Alternative Name(s):

dsbA; PSPTO_0341Thiol:disulfide interchange protein DsbA

Species: (Organism)

Pseudomonas syringae pv. tomato (strain DC3000)

Gene Names:

dsbA

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

AEPIESGKQYVELTSAVPVAVPGKIEVIELFWYGCPHCYAFEPTINPWVEKLPSDVNFVRIPAMFGGPWDAHGQLFITLDTMGVEHKVHAAVFEAIQKGGKRLTDKNDMADFVATQGVNKDDFLKTFDSFAVKGKIAQYKELAKKYEVTGVPTMIVNGKYRFDLGSAGGPEKTLQVADQLIDKERAAAKAAK

Expression Region:

23-214aa

Subcellular Location:

Periplasm

Tissue Specificity:

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

25.1 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Involved in disulfide-bond formation. Acts by transferring its disulfide bond to other proteins (By similarity).

Involvement in disease:

Relevance:

Involved in disulfide-bond formation. Acts by transferring its disulfide bond to other proteins .

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Thioredoxin family, DsbA subfamily

Reference:

Kloek A.P., Kunkel B.N.The complete genome sequence of the Arabidopsis and tomato pathogen Pseudomonas syringae pv. tomato DC3000.Buell C.R., Joardar V., Lindeberg M., Selengut J., Paulsen I.T., Gwinn M.L., Dodson R.J., DeBoy R.T., Durkin A.S., Kolonay J.F., Madupu R., Daugherty S.C., Brinkac L.M., Beanan M.J., Haft D.H., Nelson W.C., Davidsen T.M., Zafar N. , Zhou L., Liu J., Yuan Q., Khouri H.M., Fedorova N.B., Tran B., Russell D., Berry K.J., Utterback T.R., Van Aken S.E., Feldblyum T.V., D'Ascenzo M., Deng W.-L., Ramos A.R., Alfano J.R., Cartinhour S., Chatterjee A.K., Delaney T.P., Lazarowitz S.G., Martin G.B., Schneider D.J., Tang X., Bender C.L., White O., Fraser C.M., Collmer A.Proc. Natl. Acad. Sci. U.S.A. 100:10181-10186(2003)