Alternative Name(s):

Pollen allergen Mer a 1 Allergen: Mer a 1

Species: (Organism)

Mercurialis annua (Annual mercury)

Gene Names:

N/A

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPGHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIEQGM

Expression Region:

1-133aa

Subcellular Location:

Cytoplasm, cytoskeleton

Tissue Specificity:

Protein Length:

Full Length

Pathway:

Mol. Weight:

30.3 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG (By similarity).

Involvement in disease:

Relevance:

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Profilin family

Reference:

"Characterization of recombinant Mercurialis annua major allergen Mer a 1 (profilin)."Vallverdu A., Asturias J.A., Arilla M.C., Gomez-Bayon N., Martinez A., Martinez J., Palacios R.J. Allergy Clin. Immunol. 101:363-370(1998)