Recombinant Streptomyces achromogenes Modification methylase SacI(sacIM) CSB-EP523234FNS
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
Cytosine-specific methyltransferase SacI
Species: (Organism)
Streptomyces achromogenes
Gene Names:
sacIM
Tag info:
N-terminal 6xHis-SUMO-tagged
Target Protein AA Sequence:
MNHELPVISLFSGAGGLDCAIESCAEPPLVQDGSGSPLRVAVATDYEQTALDTLSANFPHTKTLCGDIQTIPTAELLEAGGLKPGDPTLVIGGPPCTPFSKSGFWIEEKRNSADPNASLLDEYVRVVRESKPEAFILENVQGLTYKTHQAQFDRLIAGLKDAGYNPTFRVLLAAEYGVPQLRRRVFVVGRRDGKAFHFPETTHSGESERDRVIDHTKIPFTSLREALAGLPDVPEAGEVVEGTYAELAAEVPPGQNYLWHTDRYGGRNEFKWRSRYWTFLLKADPDRPSTTLQAQPGPWVGPFHWENVKNANGEERARRFRVAEMKRIMTFPDEFVFTGVKREVQRQIGNPVPVELGKVVVRALMEQLGYLDSRGTTIPSQAGHEQLELI
Expression Region:
1-390aa
Subcellular Location:
Tissue Specificity:
Protein Length:
Full Length
Pathway:
Mol. Weight:
59.3 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Others
Function:
This methylase recognizes the double-stranded sequence GAGCTC, causes specific methylation on C-4 on both strands, and protects the DNA from cleavage by the SacI endonuclease.
Involvement in disease:
Relevance:
This methylase recognizes the double-stranded sequence GAGCTC, causes specific methylation on C-4 on both strands, and protects the DNA from cleavage by the SacI endonuclease.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Class I-like SAM-binding methyltransferase superfamily, C5-methyltransferase family
Reference:
Cloning and expression of the ApaLI, NspI, NspHI, SacI, ScaI, and SapI restriction-modification systems in Escherichia coli.Xu S.-Y., Xiao J.-P., Ettwiller L., Holden M., Aliotta J., Poh C.L., Dalton M., Robinson D.P., Petronzio T.R., Moran L., Ganatra M., Ware J., Slatko B., Benner J. IIMol. Gen. Genet. 260:226-231(1998)
