Recombinant Bacillus subtilis Expansin-yoaJ(yoaJ) CSB-EP522026BRJ
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
EXLX1
Species: (Organism)
Bacillus subtilis (strain 168)
Gene Names:
yoaJ
Tag info:
N-terminal 6xHis-SUMO-tagged
Target Protein AA Sequence:
AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Expression Region:
26-232aa
Subcellular Location:
Secreted, cell wall
Tissue Specificity:
Protein Length:
Full Length of Mature Protein
Pathway:
Mol. Weight:
38.9 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Others
Function:
May promote colonization of plant roots. May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. Has very low expansin activity (in vitro). No enzymatic activity has been found. Binds to peptidoglycan and to plant cell walls.
Involvement in disease:
Relevance:
May promote colonization of plant roots. May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. Has very low expansin activity (in vitro). No enzymatic activity has been found. Binds to peptidoglycan and to plant cell walls.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Reference:
Crystal structure and activity of Bacillus subtilis YoaJ (EXLX1), a bacterial expansin that promotes root colonization.Kerff F., Amoroso A., Herman R., Sauvage E., Petrella S., Filee P., Charlier P., Joris B., Tabuchi A., Nikolaidis N., Cosgrove D.J.Proc. Natl. Acad. Sci. U.S.A. 105:16876-16881(2008)
