Alternative Name(s):

Dermonecrotic toxin LamSicTox-alphaIC1; EC 4.6.1.-; Phospholipase D; PLD; Sphingomyelin phosphodiesterase D; SMD; SMase D; Sphingomyelinase D; Fragment

Species: (Organism)

Loxosceles amazonica (Recluse spider)

Gene Names:

N/A

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

WIMGHMVNNINQIEEFVSLGANSIETDVSFDKKANPEYTYHGTPCDCGRDCLRWEYFKDFLNGLRKATTPGDAKYREKLILVVFDLKTGSLYDNQAYDAGKSLAKNLLEYYWNNGNNGGRAYIVLSIPNLAHYKLVTGFKETLKDEGHEDLLEKVGHDFSGNDDIPDIESAYKKAGVTGHVWQSDGITNCLPRTLKRVILAIANRDSGSGIINKVYYWTVDKRSTTRDSLEAGVDGIMTNYPDVIADVLSEAAYKDKYRIATYDDNPWETFKA

Expression Region:

1-273aa

Subcellular Location:

Secreted

Tissue Specificity:

Expressed by the venom gland.

Protein Length:

Full Length

Pathway:

Mol. Weight:

34.8 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Catalyzes the hydrolysis of sphingomyelin. May also act on other phosphatidyl esters. Induces complement-dependent hemolysis, dermonecrosis, blood vessel permeability and platelet aggregation (By similarity).

Involvement in disease:

Relevance:

Catalyzes the hydrolysis of sphingomyelin. May also acts on other phosphatidyl esters. Induces complent-dependent holysis, dermonecrosis, blood vessel permeability and platelet aggregation .

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Arthropod phospholipase D family, Class II subfamily

Reference:

Molecular evolution, functional variation, and proposed nomenclature of the gene family that includes sphingomyelinase D in sicariid spider venoms.Binford G.J., Bodner M.R., Cordes M.H., Baldwin K.L., Rynerson M.R., Burns S.N., Zobel-Thropp P.A.Mol. Biol. Evol. 26:547-566(2009)