Alternative Name(s):

Holliday junction nuclease RuvC Holliday junction resolvase RuvC

Species: (Organism)

Akkermansia muciniphila (strain ATCC BAA-835 / Muc)

Gene Names:

ruvC

Tag info:

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein AA Sequence:

MRILAIDPAIRNTGYAVVEGDYRRARALDYGTLSIPRSVSQSGCLLAIKQHLGNLIDKWNPDEMAVERIIYVQSHQTAITMGAAKAAVVIAAAEAGLRIMEYSPKSVKLSVVGRGAAQKTQVAFMVRALLELRETPESDAADALAIGLTHLFSADPLKAHMMERKYI

Expression Region:

1-167aa

Subcellular Location:

Tissue Specificity:

Protein Length:

Full Length

Pathway:

Mol. Weight:

23.2 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Epigenetics and Nuclear Signaling

Function:

Nuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous arms and leaves a 5'-terminal phosphate and a 3'-terminal hydroxyl group.

Involvement in disease:

Relevance:

Nuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous arms and leaves a 5'-terminal phosphate and a 3'-terminal hydroxyl group.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

RuvC family

Reference:

"The genome of Akkermansia muciniphila, a dedicated intestinal mucin degrader, and its use in exploring intestinal metagenomes." van Passel M.W., Kant R., Zoetendal E.G., Plugge C.M., Derrien M., Malfatti S.A., Chain P.S., Woyke T., Palva A., de Vos W.M., Smidt H. PLoS ONE 6:E16876-E16876(2011)