Recombinant Influenza B virus Nuclear export protein(NS) CSB-EP362296IJZa0
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
NEP (Non-structural protein 2) (NS2)
Species: (Organism)
Influenza B virus (strain B/Yamagata/1/1973)
Gene Names:
NS
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
MADNMTTTQIEWRMKKMAIGSSTHSSSVLMKDIQSQFEQLKLRWESYPNLVKSTDYHQRRETIRLVTEELYLLSKRIDDNILFHKTVIANSSIIADMIVSLSLLETLYEMKDVVEVYSRQCL
Expression Region:
1-122aa
Subcellular Location:
Tissue Specificity:
Protein Length:
Full Length
Pathway:
Mol. Weight:
18.4 kDa
Purity:
Greater than 85% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Microbiology
Function:
Involvement in disease:
Relevance:
Mediates the nuclear export of encapsidated genomic RNAs . Acts as an adapter between viral RNPs complexes and the nuclear export machinery of the cell. Possesses no intrinsic RNA-binding activity, but includes a C-terminal M1-binding domain. This domain is believed to allow recognition of RNPs bound to the protein M1. Since protein M1 is not available in large quantities before late stages of infection, such an indirect recognition mechanism probably ensures that genomic RNPs are not exported from the host nucleus until sufficient quantities of viral mRNA and progeny genomic RNA have been synthesized. Furthermore, the RNPs enter the host cytoplasm only when associated with the M1 protein that is necessary to guide them to the plasma membrane. May down-regulate viral RNA synthesis when overproduced.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Reference:
"Infectious influenza A and B virus variants with long carboxyl terminal deletions in the NS1 polypeptides." Norton G.P., Tanaka T., Tobita K., Nakada S., Buonagurio D.A., Greenspan D., Krystal M., Palese P. Virology 156:204-213(1987)
