Alternative Name(s):

Virion membrane protein M25

Species: (Organism)

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

Gene Names:

VACWR088

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTG

Expression Region:

2-183aa

Subcellular Location:

Virion membrane, Single-pass membrane protein

Tissue Specificity:

Protein Length:

Partial

Pathway:

Mol. Weight:

24.8 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell.

Involvement in disease:

Relevance:

Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Chordopoxvirinae L1 family

Reference:

"Nucleotide sequence of a cluster of early and late genes in a conserved segment of the vaccinia virus genome." Plucienniczak A., Schroeder E., Zettlmeissl G., Streeck R.E. Nucleic Acids Res. 13:985-998(1985)