Alternative Name(s):

Genome polyprotein [Cleaved into: P1; Capsid protein VP0; VP4-VP2); Capsid protein VP4; P1A; Virion protein 4); Capsid protein VP2; P1B; Virion protein 2); Capsid protein VP3; P1C; Virion protein 3); Capsid protein VP1; P1D; Virion protein 1); P2; Protease 2A; P2A; EC 3.4.22.29; Picornain 2A; Protein 2A); Protein 2B; P2B); Protein 2C; P2C; EC 3.6.1.15); P3; Protein 3AB; Protein 3A; P3A); Viral protein genome-linked; VPg; Protein 3B; P3B); Protein 3CD; EC 3.4.22.28); Protease 3C; EC 3.4.22.28; Picornain 3C; P3C); RNA-directed RNA polymerase; RdRp; EC 2.7.7.48; 3D polymerase; 3Dpol; Protein 3D; 3D)]

Species: (Organism)

Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89)

Gene Names:

N/A

Tag info:

N-terminal 10xHis-tagged

Target Protein AA Sequence:

NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRPPRAVAYQHTHSTNYIPSNGEATTQIKTRPDVFTVTNV

Expression Region:

575-866aa

Subcellular Location:

Capsid protein VP0: Virion, Host cytoplasm, SUBCELLULAR LOCATION: Capsid protein VP4: Virion, SUBCELLULAR LOCATION: Capsid protein VP2: Virion, Host cytoplasm, SUBCELLULAR LOCATION: Capsid protein VP3: Virion, Host cytoplasm, SUBCELLULAR LOCATION: Capsid protein VP1: Virion, Host cytoplasm, SUBCELLULAR LOCATION: Protein 2B: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication, These vesicles are derived from the endoplasmic reticulum, SUBCELLULAR LOCATION: Protein 2C: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication, These vesicles are derived from the endoplasmic reticulum, SUBCELLULAR LOCATION: Protein 3A: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication, These vesicles are derived from the endoplasmic reticulum, SUBCELLULAR LOCATION: Protein 3AB: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication, These vesicles are derived from the endoplasmic reticulum, SUBCELLULAR LOCATION: Viral protein genome-linked: Virion, Host cytoplasm, SUBCELLULAR LOCATION: Protease 3C: Host cytoplasm, SUBCELLULAR LOCATION: Protein 3CD: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Note=Probably localizes to the surface of intracellular membrane vesicles that are induced after virus infection as the site for viral RNA replication, These vesicles are derived from the endoplasmic reticulum, SUBCELLULAR LOCATION: RNA-directed RNA polymerase: Host cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side

Tissue Specificity:

Protein Length:

Partial

Pathway:

Mol. Weight:

38.1 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Capsid protein VP1

Involvement in disease:

Relevance:

Capsid protein VP1: Forms an icosahedral capsid of pseudo T=3 symmetry with capsid proteins VP2 and VP3. The capsid is 300 Angstroms in diameter, composed of 60 copies of each capsid protein and enclosing the viral positive strand RNA genome. Capsid protein VP1 mainly forms the vertices of the capsid. Capsid protein VP1 interacts with host cell receptor to provide virion attachment to target host cells. This attachment induces virion internalization. Tyrosine kinases are probably involved in the entry process. After binding to its receptor, the capsid undergoes conformational changes. Capsid protein VP1 N-terminus (that contains an amphipathic alpha-helix) and capsid protein VP4 are externalized. Together, they shape a pore in the host membrane through which viral genome is translocated to host cell cytoplasm. After genome has been released, the channel shrinks

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Picornaviruses polyprotein family

Reference:

"Evolutionary relationships within the human rhinovirus genus: comparison of serotypes 89, 2, and 14." Duechler M., Skern T., Sommergruber W., Neubauer C., Gruendler P., Fogy I., Blaas D., Kuechler E. Proc. Natl. Acad. Sci. U.S.A. 84:2605-2609(1987)