Alternative Name(s):

65KDA matrix phosphoprotein Phosphoprotein UL83 Tegument protein UL83

Species: (Organism)

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Gene Names:

UL83

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

FDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGAAQGDDDVWTSGSDSDEELVTTERKTPRVTGGGAMAGASTSAGRKRKSASSATACTSGVMTRGRLKAESTVAPEEDTDEDSDNEIHNPA

Expression Region:

351-480aa

Subcellular Location:

Virion tegument, Host nucleus, Host cytoplasm

Tissue Specificity:

Protein Length:

Partial

Pathway:

Mol. Weight:

18.2 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Microbiology

Function:

Counteracts the host antiviral immune response when activated and phosphorylated, by preventing IRF3 from entering the nucleus. Also participates in the transactivation of viral major immediate-early genes by the recruitment of host IFI16 to the promoters pf these genes.

Involvement in disease:

Relevance:

Counteracts the host antiviral immune response when activated and phosphorylated, by preventing IRF3 from entering the nucleus. Also participates in the transactivation of viral major immediate-early genes by the recruitment of host IFI16 to the promoters pf these genes.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Herpesviridae pp65 family

Reference:

"Cloning and physical mapping of a gene fragment coding for a 64-kilodalton major late antigen of human cytomegalovirus."Pande H., Baak S.W., Riggs A.D., Clark B.R., Shively J.E., Zaia J.A.Proc. Natl. Acad. Sci. U.S.A. 81:4965-4969(1984)