Alternative Name(s):

Stable signal peptide Short name: SSP Glycoprotein G1 Short name: GP1 Glycoprotein G2 Short name: GP2

Species: (Organism)

Lymphocytic choriomeningitis virus (strain Armstrong) (LCMV)

Gene Names:

GPC

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

GTFTWTLSDSSGVENPGGYCLTKWMILAAELKCFGNTAVAKCNVNHDAEFCDMLRLIDYNKAALSKFKEDVESALHLFKTTVNSLISDQLLMRNHLRDLMGVPYCNYSKFWYLEHAKTGETSVPKCWLVTNGSYLNETHFSDQIEQEADNMITEMLRKDYIKRQGSTPLALMDLLMFSTSAYLVSIFLHLVKIPTHRHIKGGSCPKPHRLTNKGICSCGAFKVPGVKTVWKRR

Expression Region:

266-498aa

Subcellular Location:

Stable signal peptide: Virion membrane, Multi-pass membrane protein, Host cell membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: Glycoprotein G1: Virion membrane, Peripheral membrane protein, Host cell membrane, Peripheral membrane protein, SUBCELLULAR LOCATION: Glycoprotein G2: Virion membrane, Single-pass membrane protein, Host cell membrane, Single-pass membrane protein

Tissue Specificity:

Protein Length:

Partial

Pathway:

Mol. Weight:

42.4 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Microbiology

Function:

Stable signal peptide is cleaved but is apparently retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational cleavage of GP1 and GP2, glycoprotein transport to the cell plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.

Involvement in disease:

Relevance:

Stable signal peptide (SSP) is cleaved but is apparently retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational cleavage of GP1 and GP2, glycoprotein transport to the cell plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Arenaviridae GPC protein family

Reference:

"Molecular characterization of the genomic S RNA segment from lymphocytic choriomeningitis virus."Southern P.J., Singh M.K., Riviere Y., Jacoby D.R., Buchmeier M.J., Oldstone M.B.A.Virology 157:145-155(1987)