Recombinant Epstein-Barr virus Envelope glycoprotein B(gB),partial CSB-EP355975EFA
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
GP115 Glycoprotein GP110
Species: (Organism)
Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)
Gene Names:
gB
Tag info:
N-terminal 6xHis-SUMO-tagged
Target Protein AA Sequence:
QTPEQPAPPATTVQPTATRQQTSFPFRVCELSSHGDLFRFSSDIQCPSFGTRENHTEGLLMVFKDNIIPYSFKVRSYTKIVTNILIYNGWYADSVTNRHEEKFSVDSYETDQMDTIYQCYNAVKMTKDGLTRVYVDRDGVNITVNLKPTGGLANGVRRYASQTELYDAPGWLIWTYRTRTTVNCLITDMMAKSNSPFDFFVTTTGQTVEMSPFYDGKNKETFHERADSFHVRTNYKIV
Expression Region:
23-260aa
Subcellular Location:
Virion membrane, Single-pass type I membrane protein, Host cell membrane, Single-pass type I membrane protein, Host endosome membrane, Single-pass type I membrane protein, Host Golgi apparatus membrane, Single-pass type I membrane protein
Tissue Specificity:
Protein Length:
Partial
Pathway:
Mol. Weight:
43.3 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Others
Function:
Envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the initial attachment to heparan sulfate moities of the host cell surface proteoglycans. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding to its host receptors, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May be involved in the fusion between the virion envelope and the outer nuclear membrane during virion egress.
Involvement in disease:
Relevance:
Envelope glycoprotein that forms spikes at the surface of virion envelope. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding of gp350/220 to its receptor, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May also be involved in the fusion between the virion envelope and the outer nuclear membrane during virion morphogenesis
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Herpesviridae glycoprotein B family
Reference:
"Epstein-Barr virus glycoprotein homologous to herpes simplex virus gB."Gong M., Ooka T., Matsuo T., Kieff E.J. Virol. 61:499-508(1987)
