Alternative Name(s):

Short name: Alpha-BTX A31 Short name: Alpha-Bgt(A31) Short name: BGTX A31 Alternative name(s): Long neurotoxin 1

Species: (Organism)

Bungarus multicinctus (Many-banded krait)

Gene Names:

N/A

Tag info:

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Target Protein AA Sequence:

IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG

Expression Region:

22-95aa

Subcellular Location:

Secreted

Tissue Specificity:

Expressed by the venom gland.

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

38 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Binds with high affinity to muscular (alpha-1/CHRNA1) and neuronal (alpha-7/CHRNA7) nicotinic acetylcholine receptor (nAChR) and inhibits acetylcholine from binding to the receptor, thereby impairing neuromuscular and neuronal transmission. Blocks the extracellular increase of dopamine evoked by nicotine only at the higher dose (4.2 uM).

Involvement in disease:

Relevance:

Binds with high affinity to muscular (alpha-1/CHRNA1) and neuronal (alpha-7/CHRNA7) nicotinic acetylcholine receptor (nAChR) and inhibits acetylcholine from binding to the receptor, thereby impairing neuromuscular and neuronal transmission. Blocks the extracellular increase of dopamine evoked by nicotine only at the higher dose (4.2 µM).

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Snake three-finger toxin family, Long-chain subfamily, Type II alpha-neurotoxin sub-subfamily

Reference:

"Genetic organization of alpha-bungarotoxins from Bungarus multicinctus (Taiwan banded krait): evidence showing that the production of alpha-bungarotoxin isotoxins is not derived from edited mRNAs." Chang L.-S., Lin S.-K., Huang H.-B., Hsiao M. Nucleic Acids Res. 27:3970-3975(1999)