Alternative Name(s):

Hydrophobin I Short name:HFBI

Species: (Organism)

Hypocrea jecorina (Trichoderma reesei)

Gene Names:

hfb1

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

SNGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA

Expression Region:

23-97aa

Subcellular Location:

Secreted, cell wall, Secreted

Tissue Specificity:

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

23.5 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Microbiology

Function:

Contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures.

Involvement in disease:

Relevance:

Contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Cerato-ulmin hydrophobin family

Reference:

"Genetic and biochemical characterization of the Trichoderma reesei hydrophobin HFBI."Nakari-Setaelae T., Aro N., Kalkkinen N., Alatalo E., Penttilae M.Eur. J. Biochem. 235:248-255(1996)