Recombinant Saccharomyces cerevisiae Nicotinamidase(PNC1) CSB-EP346834SVG
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
Nicotine deamidase Short name: NAMase
Species: (Organism)
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Gene Names:
PNC1
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK
Expression Region:
1-216aa
Subcellular Location:
Cytoplasm, Nucleus, Peroxisome
Tissue Specificity:
Protein Length:
Full Length
Pathway:
Mol. Weight:
29 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Microbiology
Function:
Catalyzes the deamidation of nicotinamide, an early step in the NAD(+) salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate.
Involvement in disease:
Relevance:
Catalyzes the deamidation of nicotinamide, an early step in the NAD+ salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Isochorismatase family
Reference:
"Identification and functional analysis of the Saccharomyces cerevisiae nicotinamidase gene, PNC1."Ghislain M., Talla E., Francois J.M.Yeast 19:215-224(2002).
