Alternative Name(s):

Islet of Langerhans regenerating protein 1 Short name:REG 1 Pancreatic stone protein 1 Short name:PSP Pancreatic thread protein 1 Short name:PTP Regenerating protein 1

Species: (Organism)

Mus musculus (Mouse)

Gene Names:

Reg1

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG

Expression Region:

22-165aa

Subcellular Location:

Secreted

Tissue Specificity:

Expressed only in regenerating islets and normal exocrine pancreas, but not in normal pancreatic islets. Expressed strongly in pancreas, moderately in gall bladder, and weakly in liver.

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

32.2 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cell Biology

Function:

Might act as an inhibitor of spontaneous calcium carbonate precipitation.

Involvement in disease:

Relevance:

Might act as an inhibitor of spontaneous calcium carbonate precipitation.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)