Alternative Name(s):

2S albumin; GM2S-1; Napin-type 2S albumin 3) [Cleaved into: 2S albumin small chain; Aspartic acid-rich peptide; Lunasin); 2S albumin large chain; 8 kDa methionine-rich protein; 8 kDa MRP)]

Species: (Organism)

Glycine max (Soybean) (Glycine hispida)

Gene Names:

N/A

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDDNHILRTMRGRINYIRRNEGKDEDEEEEGHMQKCCTEMSELRSPKCQCKALQKIMENQSEELEEKQKKKMEKELINLATMCRFGPMIQCDLSSDD

Expression Region:

22-158aa

Subcellular Location:

Tissue Specificity:

Expressed in cotyledons (Ref.2). Maximal expression in parenchyma cells undergoing DNA endoreduplication and cell expansion but not in actively dividing cells of the cotyledon (PubMed:10331812).

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

32.2 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

This is a 2S seed storage protein.

Involvement in disease:

Relevance:

This is a 2S seed storage protein.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

2S seed storage albumins family

Reference:

A soybean cDNA encoding a chromatin-binding peptide inhibits mitosis of mammalian cells.Galvez A.F., de Lumen B.O.Nat. Biotechnol. 17:495-500(1999)