Alternative Name(s):

Coat protein VP1

Species: (Organism)

Porcine parvovirus (strain NADL-2) (PPV)

Gene Names:

N/A

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

MAPPAKRARGLTLPGYKYLGPGNSLDQGEPTNPSDAAAKEHDEAYDKYIKSGKNPYFYFSAADEKFIKETEHAKDYGGKIGHYFFRAKRAFAPKLSETDSPTTSQQPEVRRSPRKHPGSKPPGKRPAPRHIFINLAKKKAKGTSNTNSNSMSENVEQHNPINAGTELSATGNESGGGGGGGGGRGAGGVGVSTGTFNNQTEFQYLGE

Expression Region:

1-207aa

Subcellular Location:

Virion, Host nucleus

Tissue Specificity:

Protein Length:

Partial

Pathway:

Mol. Weight:

26.1 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Capsid protein self-assembles to form an icosahedral capsid with a T=1 symmetry, about 22 nm in diameter, and consisting of 60 copies of two size variants of the capsid proteins, VP1 and VP2, which differ by the presence of an N-terminal extension in the minor protein VP1. The capsid encapsulates the genomic ssDNA. Capsid proteins are responsible for the attachment to host cell receptors. This attachment induces virion internalization predominantly through clathrin-dependent endocytosis. Binding to the host receptors also induces capsid rearrangements leading to surface exposure of VP1 N-terminus, specifically its phospholipase A2-like region and putative nuclear localization signal(s). VP1 N-terminus might serve as a lipolytic enzyme to breach the endosomal membrane during entry into host cell and might contribute to virus transport to the nucleus (By similarity).

Involvement in disease:

Relevance:

Capsid protein self-assembles to form an icosahedral capsid with a T=1 symmetry, about 22 nm in diameter, and consisting of 60 copies of two size variants of the capsid proteins, VP1 and VP2, which differ by the presence of an N-terminal extension in the minor protein VP1. The capsid encapsulates the genomic ssDNA. Capsid proteins are responsible for the attachment to host cell receptors. This attachment induces virion internalization predominantly through clathrin-dependent endocytosis. Binding to the host receptors also induces capsid rearrangements leading to surface exposure of VP1 N-terminus, specifically its phospholipase A2-like region and putative nuclear localization signal(s). VP1 N-terminus might serve as a lipolytic enzyme to breach the endosomal membrane during entry into host cell and might contribute to virus transport to the nucleus

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Parvoviridae capsid protein family

Reference:

"Porcine parvovirus: DNA sequence and genome organization." Ranz A.I., Manclus J.J., Diaz-Aroca E., Casal J.I. J. Gen. Virol. 70:2541-2553(1989)