Alternative Name(s):

Sialic acid-binding lectin; EC 3.1.27.-

Species: (Organism)

Rana japonica (Japanese reddish frog)

Gene Names:

N/A

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

QNWAKFQEKHIPNTSNINCNTIMDKSIYIVGGQCKERNTFIISSATTVKAICSGASTNRNVLSTTRFQLNTCIRSATAPRPCPYNSRTETNVICVKCENRLPVHFAGIGRC

Expression Region:

1-111aa

Subcellular Location:

Secreted

Tissue Specificity:

Protein Length:

Full Length

Pathway:

Mol. Weight:

16.3 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

The S-lectins in frog eggs may be involved in the fertilization and development of the frog embryo. This lectin preferentially agglutinate a large variety of tumor cells, but it does not agglutinate non-transformed cells and erythrocytes.

Involvement in disease:

Relevance:

The S-lectins in frog eggs may be involved in the fertilization and development of the frog bryo. This lectin preferentially agglutinate a large variety of tumor cells, but it does not agglutinate non-transformed cells and erythrocytes.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Pancreatic ribonuclease family

Reference:

Amino acid sequence of a lectin from Japanese frog (Rana japonica) eggs.Kamiya Y., Oyama F., Oyama R., Sakakibara F., Nitta K., Kawauchi H., Takayanagi Y., Titani K.J. Biochem. 108:139-143(1990)