Alternative Name(s):

Cysteine-rich antimicrobial protein 1 Defensin AMP1

Species: (Organism)

Dahlia merckii (Bedding dahlia)

Gene Names:

N/A

Tag info:

N-terminal 6xHis-B2M-tagged

Target Protein AA Sequence:

ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC

Expression Region:

1-50aa

Subcellular Location:

Secreted

Tissue Specificity:

Protein Length:

Full Length

Pathway:

Mol. Weight:

19.5 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Possesses antimicrobial activity sensitive to inorganic cations. Has no inhibitory effect on insect gut alpha-amylase. Induces potential changes in fungal membranes and increased K+ efflux and Ca(2+) uptake. Interacts with sphingolipids and ergosterols found in fungal plasma membranes.

Involvement in disease:

Relevance:

Possesses antimicrobial activity sensitive to inorganic cations. Has no inhibitory effect on insect gut alpha-amylase. Induces potential changes in fungal membranes and increased K+ efflux and Ca2+ uptake. Interacts with sphingolipids and ergosterols found in fungal plasma membranes.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

DEFL family

Reference:

"Fungal membrane responses induced by plant defensins and thionins." Thevissen K., Ghazi A., De Samblanx G.W., Brownlee C., Osborn R.W., Broekaert W.F. J. Biol. Chem. 271:15018-15025(1996)