Alternative Name(s):

Coat protein C, polypeptide II G9P

Species: (Organism)

Enterobacteria phage M13 (Bacteriophage M13)

Gene Names:

IX

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

MSVLVYSFASFVLGWCLRSGITYFTRLMETSS

Expression Region:

1-32aa

Subcellular Location:

Virion, Host membrane, Single-pass membrane protein

Tissue Specificity:

Protein Length:

Full Length

Pathway:

Mol. Weight:

19.7 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Microbiology

Function:

May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host.

Involvement in disease:

Relevance:

May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Inovirus G9P protein family

Reference:

"Nucleotide sequence of the filamentous bacteriophage M13 DNA genome: comparison with phage fd."van Wezenbeek P.M.G.F., Hulsebos T.J.M., Schoenmakers J.G.G.Gene 11:129-148(1980)