Alternative Name(s):

Braun lipoprotein (Murein-lipoprotein) (mlpA) (mulI)

Species: (Organism)

Escherichia coli (strain K12)

Gene Names:

lpp

Tag info:

N-terminal 6xHis-KSI-tagged

Target Protein AA Sequence:

CSSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYRK

Expression Region:

21-78aa

Subcellular Location:

Cell outer membrane, Lipid-anchor, Cell outer membrane, Peptidoglycan-anchor

Tissue Specificity:

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

21.8 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

Interacts with the peptidoglycan both covalently and noncovalently. This interaction contributes to the maintenance of the structural and functional integrity of the cell envelope.

Involvement in disease:

Relevance:

Interacts with the peptidoglycan both covalently and noncovalently. This interaction contributes to the maintenance of the structural and functional integrity of the cell envelope.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Lpp family

Reference:

"Roles of the hydrophobic cavity and lid of LolA in the lipoprotein transfer reaction in Escherichia coli." Watanabe S., Matsuyama S., Tokuda H. J. Biol. Chem. 281:3335-3342(2006)