Alternative Name(s):

Ankyrin-like with transmembrane domains protein 1 Transformation-sensitive protein p120

Species: (Organism)

Homo sapiens (Human)

Gene Names:

TRPA1

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

IGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP

Expression Region:

957-1119aa

Subcellular Location:

Cell membrane, Multi-pass membrane protein

Tissue Specificity:

Expressed at very low level. Expressed at very low level in human fibroblasts and at a moderate level in liposarcoma cells.

Protein Length:

Partial

Pathway:

Mol. Weight:

35.2 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Neuroscience

Function:

Receptor-activated non-selective cation channel involved in detection of pain and possibly also in cold perception and inner ear function

Involvement in disease:

Episodic pain syndrome, familial, 1 (FEPS1)

Relevance:

Receptor-activated non-selective cation channel involved in detection of pain and possibly also in cold perception and inner ear function (PubMed:25389312, PubMed:25855297). Has a central role in the pain response to endogenous inflammatory mediators and to a diverse array of volatile irritants, such as mustard oil, cinnamaldehyde, garlic and acrolein, an irritant from tears gas and vehicule exhaust fumes (PubMed:25389312, PubMed:20547126). Is also activated by menthol (in vitro)(PubMed:25389312). Acts also as a ionotropic cannabinoid receptor by being activated by delta(9)-tetrahydrocannabinol (THC), the psychoactive component of marijuana (PubMed:25389312). May be a component for the mechanosensitive transduction channel of hair cells in inner ear, thereby participating in the perception of sounds. Probably operated by a phosphatidylinositol second messenger system (By similarity).

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Transient receptor (TC 1.A.4) family

Reference:

"A gain-of-function mutation in TRPA1 causes familial episodic pain syndrome."Kremeyer B., Lopera F., Cox J.J., Momin A., Rugiero F., Marsh S., Woods C.G., Jones N.G., Paterson K.J., Fricker F.R., Villegas A., Acosta N., Pineda-Trujillo N.G., Ramirez J.D., Zea J., Burley M.W., Bedoya G., Bennett D.L., Wood J.N., Ruiz-Linares A.Neuron 66:671-680(2010).