Alternative Name(s):

Protein MIG-5Tissue inhibitor of metalloproteinases 3 ;TIMP-3

Species: (Organism)

Homo sapiens (Human)

Gene Names:

TIMP3

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

HPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINA

Expression Region:

30-208aa

Subcellular Location:

Secreted, extracellular space, extracellular matrix

Tissue Specificity:

Protein Length:

Partial

Pathway:

Mol. Weight:

24.8 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Neuroscience

Function:

Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.

Involvement in disease:

Sorsby fundus dystrophy (SFD)

Relevance:

Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates th by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to rodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Protease inhibitor I35 (TIMP) family

Reference:

Structure and expression in breast tumors of human TIMP-3, a new member of the metalloproteinase inhibitor family.Uria J.A., Ferrando A.A., Velasco G., Freije J.M., Lopez-Otin C.Cancer Res. 54:2091-2094(1994)