Alternative Name(s):

DXS9822; Inner mitochondrial membrane preprotein translocase; JM3; Mitochondrial import inner membrane translocase subunit Tim17-B; TI17B_HUMAN; Tim17b; TIMM17B; Translocase of inner mitochondrial membrane 17 homolog B (yeast)

Species: (Organism)

Homo sapiens (Human)

Gene Names:

TIMM17B

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH

Expression Region:

1-172aa

Subcellular Location:

Mitochondrion inner membrane, Multi-pass membrane protein

Tissue Specificity:

Expression is abundant in heart and skeletal muscle, intermediate in brain, and weak in pancreas, placenta, kidney and liver.

Protein Length:

Full Length

Pathway:

Mol. Weight:

45.3 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Involvement in disease:

Relevance:

Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Tim17/Tim22/Tim23 family

Reference:

"Genetic and structural characterization of the human mitochondrial inner membrane translocase." Bauer M.F., Gempel K., Reichert A.S., Rappold G.A., Lichtner P., Gerbitz K.-D., Neupert W., Brunner M., Hofmann S. J. Mol. Biol. 289:69-82(1999)