Alternative Name(s):

TGFB1; Transforming growth factor beta-1 proprotein [Cleaved into: Latency-associated peptide; LAP); Transforming growth factor beta-1; TGF-beta-1)]

Species: (Organism)

Gallus gallus (Chicken)

Gene Names:

TGFB1

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

DLDTDYCFGPGTDEKNCCVRPLYIDFRKDLQWKWIHEPKGYMANFCMGPCPYIWSADTQYTKVLALYNQHNPGASAAPCCVPQTLDPLPIIYYVGRNVRVEQLSNMVVRACKCS

Expression Region:

278-391aa

Subcellular Location:

Secreted

Tissue Specificity:

Protein Length:

Partial

Pathway:

Mol. Weight:

29 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of them have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone remodeling. It is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts. Mediates SMAD2/3 activation by inducing its phosphorylation and subsequent translocation to the nucleus (By similarity).

Involvement in disease:

Relevance:

Multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of th have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone rodeling. It is a potent stimulator of osteoblastic bone formation, causing chotaxis, proliferation and differentiation in committed osteoblasts .

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

TGF-beta family

Reference:

Complementary deoxyribonucleic acid cloning of a messenger ribonucleic acid encoding transforming growth factor beta 4 from chicken embryo chondrocytes.Jakowlew S.B., Dillard P.J., Sporn M.B., Roberts A.B.Mol. Endocrinol. 2:1186-1195(1988)