Alternative Name(s):

DOPA/tyrosine sulfotransferase

Species: (Organism)

Rattus norvegicus (Rat)

Gene Names:

Sult1b1

Tag info:

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Target Protein AA Sequence:

MGTAEDVFRKDLKIIHGYPMVYAFALGWEKIEEFQSRPCDIVIPTYPKSGTTWLSEIVDMVLNDGNVEKCKRDVITSKVPMLEQNVPGARRSGVELLKKTPSPRIIKTHLPIDLLPKSFWDNKCKMIYLARNGKDVAVSYYHFDLMNNIQPLPGTWEEYLEKFLAGNVAYGSWFDHVKSWWEKREGHPILFLYYEDLKKNPKKEIKKIANFLDKTLDEHTLERIVHHTSFEVMKDNPLVNYTHLPTEIMDHSKSPFMRKGVVGDWKNYFTMTQSEKFDAIYKKKLSGTTLEFCTDIQSA

Expression Region:

1-299aa

Subcellular Location:

Cytoplasm

Tissue Specificity:

Protein Length:

Full Length

Pathway:

Mol. Weight:

54.8 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. sulfonation of DOPA, tyrosine isomers and thyroid hormones such as 3,3',5-triiodothyronine and 3,3'-diiodothyronine. May play a role in the limitation of the production of L-DOPA and L-m-tyrosine and also in facilitating their excretion.

Involvement in disease:

Relevance:

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. sulfonation of DOPA, tyrosine isomers and thyroid hormones such as 3,3',5-triiodothyronine and 3,3'-diiodothyronine. May play a role in the limitation of the production of L-DOPA and L-m-tyrosine and also in facilitating their excretion.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Sulfotransferase 1 family

Reference:

"Purification, characterization, and molecular cloning of a novel rat liver Dopa/tyrosine sulfotransferase." Sakakibara Y., Takami Y., Zwieb C., Nakayama T., Suiko M., Nakajima H., Liu M.-C. J. Biol. Chem. 270:30470-30478(1995)