Recombinant Human Sorcin(SRI) CSB-EP022665HU
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
22KDA protein CP-22
Species: (Organism)
Homo sapiens (Human)
Gene Names:
SRI
Tag info:
N-terminal GST-tagged
Target Protein AA Sequence:
MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV
Expression Region:
1-198aa
Subcellular Location:
Cytoplasm, Sarcoplasmic reticulum membrane, Peripheral membrane protein, Cytoplasmic side
Tissue Specificity:
Detected in cardiac myocytes.
Protein Length:
Full Length
Pathway:
Mol. Weight:
48.7 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Signal Transduction
Function:
Calcium-binding protein that modulates excitation-contraction coupling in the heart. Contributes to calcium homeostasis in the heart sarcoplasmic reticulum. Modulates the activity of RYR2 calcium channels.
Involvement in disease:
Relevance:
Calcium-binding protein that modulates excitation-contraction coupling in the heart. Contributes to calcium homeostasis in the heart sarcoplasmic reticulum. Modulates the activity of RYR2 calcium channels.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Reference:
"Purification, cDNA cloning, and expression of human sorcin in vincristine-resistant HOB1 lymphoma cell lines." Lee W.P. Arch. Biochem. Biophys. 325:217-226(1996)
